Protein Info for GFF4459 in Xanthobacter sp. DMC5

Annotation: Adaptive-response sensory-kinase SasA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 694 transmembrane" amino acids 30 to 54 (25 residues), see Phobius details amino acids 343 to 367 (25 residues), see Phobius details PF17202: sCache_3_3" amino acids 228 to 340 (113 residues), 103.5 bits, see alignment E=2.3e-33 PF17201: Cache_3-Cache_2" amino acids 254 to 350 (97 residues), 64.9 bits, see alignment E=2.4e-21 PF00672: HAMP" amino acids 368 to 416 (49 residues), 27.8 bits, see alignment 7.5e-10 PF00512: HisKA" amino acids 464 to 526 (63 residues), 40.9 bits, see alignment E=5.4e-14 PF02518: HATPase_c" amino acids 574 to 682 (109 residues), 88.8 bits, see alignment E=9.9e-29

Best Hits

KEGG orthology group: None (inferred from 80% identity to xau:Xaut_1291)

Predicted SEED Role

"Signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (694 amino acids)

>GFF4459 Adaptive-response sensory-kinase SasA (Xanthobacter sp. DMC5)
MAEAARTPAHKGADPPRGFLTRLRSVRMRLLAIALLPTLIILPAVLALVVTWWTRQFDRL
LISKVNGDLTIARQYLDRLRERSDETLHALGDSVAFARVTGAGNSAALADFLDARRKVMG
LDFLYLIDADGHSVAAAPAGAAREAREMWSVERRALAGTASTEIDIFGPQELERLSPQLA
DRAHIALVPTPGAVPTSREAEDRGMVVQSGTPVEMPDGQRAALVGGVLLNQNLDFIDTIN
DLVYRPGSLPEGSAGTATLFVDDVRVSTNVRLFEGRRALGTRVSQEVRNAVLGEGRVWLD
RAFVVSDWYISAYEPVVDSHGKRIGMLYVGFLEAPFLALKRASLAAVAVGFLLVAMVAIP
VLLRWAAAIFRPLEAMNATISAVEGGTLSARTGVAATSDEIGRVAHHLDDMLDLLQERDA
ELRRWTEELDRRVAERTRELEDANAELAATQRQLVMSEKLAAIGEITAGVAHEINNPVAV
IQGNLDVARDVLGSAAGPVKTEFNLIDQQVHRINVIVSKLLQFARPAEFAGHLDPVAPGE
VVGDALLLVQHLLSRSEIQVARSDAATRLVMMNRVELQQVLINLMVNAVHAMPGGGTLTV
TTRDETRGRQAGVGIEVADTGTGIPEERIGRVFDPFFTTKPQGGTGLGLSISYTLIERAG
GTMAVESPPGSGAIFSIWLPEAGSEVEEGAPHSA