Protein Info for GFF4458 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 47 to 65 (19 residues), see Phobius details amino acids 78 to 102 (25 residues), see Phobius details amino acids 120 to 140 (21 residues), see Phobius details amino acids 148 to 169 (22 residues), see Phobius details PF05230: MASE2" amino acids 21 to 98 (78 residues), 49.1 bits, see alignment E=7.4e-17 PF00512: HisKA" amino acids 210 to 277 (68 residues), 70.5 bits, see alignment E=1.5e-23 PF02518: HATPase_c" amino acids 325 to 439 (115 residues), 96.4 bits, see alignment E=2.2e-31

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (447 amino acids)

>GFF4458 Histidine kinase (Hydrogenophaga sp. GW460-11-11-14-LB1)
MALPGLAKAPRRLYGGVRVNYPVRIGAHLAAGLLLGSVFALQPPATLWWALVVMLTWPHI
AYWLSCRSSDSRRSEMRALLIDSFLIGVYGGLSGLNPWIIVALGGAMHASNLGSGGGRHA
VRGVVAMVIGIATGAAANGFEFRPDTSLTTIALSAVAAAIYLSLFGHAIHAESLRTARTR
AALEERNREIEAQAVHLEQARQEAEQANKAKSAFLANMSHELRTPLNAVIGYAELLEEEL
ADSAPSEARADLGRITQAAKDLLAMINAVLDLTRLDANRVRLQLEDTDLRGLLSSVEAAV
QPLLKANGNRLQVDVQPGLALVHADALRLRQVLIALVSNAAKFTARGQVRLRVFTREREP
GAPVLRFEVEDTGIGLSAEEIGRLFQPFLQADEGTTRAFGGSGLGLAISRRLCRLMGGDI
EVASTPGQGSCFTAWLPQPVPPPEHGI