Protein Info for PS417_22795 in Pseudomonas simiae WCS417

Annotation: exclusion suppressor FxsA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 32 to 55 (24 residues), see Phobius details amino acids 75 to 101 (27 residues), see Phobius details PF04186: FxsA" amino acids 6 to 113 (108 residues), 113.6 bits, see alignment E=2.6e-37

Best Hits

KEGG orthology group: K07113, UPF0716 protein FxsA (inferred from 98% identity to pfs:PFLU4989)

Predicted SEED Role

"FxsA protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UGV4 at UniProt or InterPro

Protein Sequence (158 amino acids)

>PS417_22795 exclusion suppressor FxsA (Pseudomonas simiae WCS417)
MRPFLLLFLLFPVLELFVFVEVSSAIGFFPALLLIILGSMLGVLVLRVAGLATALRARES
LNRGELPAQTMLEGLMMALAGGLLILPGFISDVVGLVMLLPFTRKLLAGKMRQRAEEAAI
RQRAFADDLQPRGGPAPRQPLGREGDVIEGEFEHRDSK