Protein Info for GFF4453 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Osmosensitive K+ channel histidine kinase KdpD (EC 2.7.3.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 503 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 182 to 204 (23 residues), see Phobius details PF00672: HAMP" amino acids 202 to 259 (58 residues), 38.2 bits, see alignment 2.9e-13 PF00512: HisKA" amino acids 271 to 339 (69 residues), 57.4 bits, see alignment E=2.4e-19 PF02518: HATPase_c" amino acids 389 to 488 (100 residues), 89.6 bits, see alignment E=3.8e-29 PF13581: HATPase_c_2" amino acids 394 to 465 (72 residues), 28.1 bits, see alignment E=3.6e-10

Best Hits

KEGG orthology group: None (inferred from 75% identity to pol:Bpro_0544)

Predicted SEED Role

"Osmosensitive K+ channel histidine kinase KdpD (EC 2.7.3.-)" in subsystem Potassium homeostasis (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (503 amino acids)

>GFF4453 Osmosensitive K+ channel histidine kinase KdpD (EC 2.7.3.-) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MRWPGRWPLSRRLSAVFVALLLACSGVSIGLQMAASERHGQEVTQRLSLGLAAHIAGNPE
LMRSDGLNEAAVRALFDQLMAVNPSVEVYLLNPQGRIVAQAAPPGHLKRDRVDLAPVQRL
LAGGPLPVLGDDPRGDGERKVFSAAPMTVNGRDAGYVYVVLSGEAREALVANATASNALR
TLLWSMALVVLLGALAGVAAFHLITRPLRELTGVVQRFERDGVASMRQAAPALDRLASDG
GDEIGTLAQAFRQMAQRIAEQWRELTAQDQQRRELFANISHDLRTPLTSLHGYLETLLMK
ADSLPEADRRRYLEIALGQSRKVGRLAQELFELARLEYGVVQPDKERFALADLVQDVFQK
FELAAQARRQRLVPEIAPGLPVVNADLGMIERVLTNLLDNAIRHTPEGGEIAVRLLPDGE
GVRVEVSDTGPGIPPELQPVIFTRPAFASGGERGGGLGLMIVRRILLLHGSDIRLVSGAG
RGAVFSFGLGPSGFGETERRPFE