Protein Info for GFF4452 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Two-component response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00072: Response_reg
  • amino acids 1 to 111 (111 residues), 92.4 bits, E=2.2e-30
• PF00486: Trans_reg_C
  • amino acids 149 to 225 (77 residues), 95.9 bits, E=1.2e-31

Best Hits

Swiss-Prot: 44% identical to REGX3_MYCS2: Sensory transduction protein regX3 (regX3) from Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)

KEGG orthology group: None (inferred from 88% identity to pol:Bpro_0543)

MetaCyc: 40% identical to DNA-binding transcriptional dual regulator CpxR (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Two-component response regulator"

Protein Sequence (235 amino acids)

>GFF4452 Two-component response regulator (Hydrogenophaga sp. GW460-11-11-14-LB1)
VLIVEDDAHIAELLRMHLRDEGYAVTHAADGDAGVRELERGSWDALVLDLTLPGVDGLEI
CRRARAMARYTPIIITSARSSEMHRILGLELGADDYLAKPFSVLELVARVRALLRRTEAM
ARNARLESGRLELGNLGIDPVAREVQLDGRPIELTPREFDLLYFFARHPDRVFSRLDLLN
QVWGYQHDGYEHTVNTHINRLRMKVEADPAVPRRILTVWGRGYKLAGGGSEEAGP