Protein Info for GFF4451 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Thiosulfate reductase cytochrome B subunit (membrane anchoring protein)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 64 to 86 (23 residues), see Phobius details amino acids 129 to 149 (21 residues), see Phobius details amino acids 170 to 193 (24 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 14 to 202 (189 residues), 94.8 bits, see alignment E=2.9e-31

Best Hits

Swiss-Prot: 70% identical to YEDZ1_AZOOP: Putative protein-methionine-sulfoxide reductase subunit YedZ1 (yedZ1) from Azospira oryzae (strain ATCC BAA-33 / DSM 13638 / PS)

KEGG orthology group: None (inferred from 79% identity to vpe:Varpa_2658)

Predicted SEED Role

"Thiosulfate reductase cytochrome B subunit (membrane anchoring protein)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (208 amino acids)

>GFF4451 Thiosulfate reductase cytochrome B subunit (membrane anchoring protein) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MDHPATPASRQPIHPRWVRLAHWINALAVLLLVTSGWRIYNASPFFPFEIPNGITLGGWL
GGAIQWHFAAMWLLVVNGLAYLALNLFSGRLRRKFFPLSIAGVWRDARAALRGRLSHADP
RHYNSVQRLAYLFVMLDIVLLVLSGLVLWKSVQFPLLRELLGGYEFARRIHFVAMAALVA
FVALHLAMVALVPRTLLTMLSGRAGKPS