Protein Info for GFF4449 in Variovorax sp. SCN45

Annotation: TldD protein, part of TldE/TldD proteolytic complex

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 489 PF01523: PmbA_TldD_1st" amino acids 47 to 110 (64 residues), 57.9 bits, see alignment E=1.4e-19 PF19290: PmbA_TldD_2nd" amino acids 138 to 246 (109 residues), 72.3 bits, see alignment E=6.5e-24 PF19289: PmbA_TldD_3rd" amino acids 254 to 487 (234 residues), 234.5 bits, see alignment E=1.3e-73

Best Hits

Swiss-Prot: 57% identical to TLDD_ECOLI: Metalloprotease TldD (tldD) from Escherichia coli (strain K12)

KEGG orthology group: K03568, TldD protein (inferred from 98% identity to vap:Vapar_0942)

MetaCyc: 57% identical to metalloprotease subunit TldD (Escherichia coli)
3.4.24.-

Predicted SEED Role

"TldD protein, part of TldE/TldD proteolytic complex"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (489 amino acids)

>GFF4449 TldD protein, part of TldE/TldD proteolytic complex (Variovorax sp. SCN45)
MAVMISREPTIERLATAQQLLLTPFGLDESHLSKALAEITAHRVDDADLYFQYTRSEGWS
LEEGIVKTGSFSIDQGVGVRAVSGEKTAFAYSDDISEASLLDAARTVRSISSAGRTGRVK
TATRKIASSRSLYQGIDPISTLDSTAKVKLLEKVEKLARSRDPRVAQVMAGLASEYDVVL
VARADGTLAADVRPLVRLSVTVIAEQNGRREIGSGGGGGRFGLAYFSDEQIAEYVDHAVK
AALTNLDARPAPAGEMTVVLGSGWPGILLHEAIGHGLEGDFNRKGSSAFSGRIGQRVAAK
GVTVLDDGTIADRRGSLNVDDEGNASQRNVLIEDGILKGYIQDSMNARLMKVKPTGNGRR
ESYAHVPMPRMTNTYMLGGDKDPKEIVASIKKGLYATNFGGGQVDITSGKFVFSASEAYW
VENGKIQYPVKGATIVGNGPDALTRVTMIGNDMALDSGVGTCGKEGQSVPVGVGQPTLRI
DGLTVGGTA