Protein Info for GFF4448 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details PF01625: PMSR" amino acids 61 to 227 (167 residues), 203.4 bits, see alignment E=1.4e-64 TIGR00401: peptide-methionine (S)-S-oxide reductase" amino acids 61 to 211 (151 residues), 162.8 bits, see alignment E=3.8e-52

Best Hits

KEGG orthology group: K07304, peptide-methionine (S)-S-oxide reductase [EC: 1.8.4.11] (inferred from 64% identity to vpe:Varpa_2655)

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11)" (EC 1.8.4.11)

Isozymes

Compare fitness of predicted isozymes for: 1.8.4.11

Use Curated BLAST to search for 1.8.4.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (245 amino acids)

>GFF4448 Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTRSLEPGTAGLSRRAATLAALALLGAAAWKVLPARAAEEAVVIPPPADDSGPAARQAAS
ETAVLAGGCFWGVQGVFQHLKGVTRAVSGYAGGDASTAKYEAIGTGRTGHAEAVRIAFDP
QQISFGQILQVYFSVAHNPTELNRQGPDRGTQYRSTVFAQTAEQARIAKAYIAQLDRARV
FGQPIATTIEREKPFFEAEAYHQDYMTLHPRQPYIVVNDLPKVDNLKRLFPERYRATPVL
VGSTK