Protein Info for GFF4442 in Variovorax sp. SCN45

Annotation: Biotin carboxyl carrier protein of acetyl-CoA carboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00531: acetyl-CoA carboxylase, biotin carboxyl carrier protein
  • amino acids 1 to 155 (155 residues), 187.6 bits, E=9.9e-60
• PF00364: Biotin_lipoyl
  • amino acids 81 to 154 (74 residues), 85.7 bits, E=1.5e-28

Best Hits

Swiss-Prot: 56% identical to BCCP_ECOLI: Biotin carboxyl carrier protein of acetyl-CoA carboxylase (accB) from Escherichia coli (strain K12)

KEGG orthology group: K02160, acetyl-CoA carboxylase biotin carboxyl carrier protein (inferred from 90% identity to vap:Vapar_0949)

MetaCyc: 56% identical to biotin carboxyl carrier protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Biotin carboxyl carrier protein of acetyl-CoA carboxylase" in subsystem Fatty Acid Biosynthesis FASII

MetaCyc Pathways

• biotin-carboxyl carrier protein assembly (4/4 steps found)
• 3-hydroxypropanoate cycle (9/13 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (11/18 steps found)
• superpathway of the 3-hydroxypropanoate cycle (11/18 steps found)
• glyoxylate assimilation (7/13 steps found)

Protein Sequence (155 amino acids)

>GFF4442 Biotin carboxyl carrier protein of acetyl-CoA carboxylase (Variovorax sp. SCN45)
MDLRKLKTLIDLVSESNISELEITETEGKVRIVKGGGAAPVQYVQTLAAPAAAAAAPAAA
GAAPAVASAPVAAEAARAGHAVKSPMVGTFYRSSSPGAPAFVEVGSKVNEGDTVCIIEAM
KILNEIEADKSGTITQILGENGQAVEYGQPLFIIE