Protein Info for PS417_22735 in Pseudomonas simiae WCS417

Annotation: thiol oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF06537: DHOR" amino acids 35 to 475 (441 residues), 326.4 bits, see alignment E=2.9e-101 PF00034: Cytochrom_C" amino acids 347 to 475 (129 residues), 23.7 bits, see alignment E=9.4e-09

Best Hits

KEGG orthology group: None (inferred from 97% identity to pfs:PFLU4973)

Predicted SEED Role

"Probable thiol oxidoreductase with 2 cytochrome c heme-binding sites"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UR42 at UniProt or InterPro

Protein Sequence (475 amino acids)

>PS417_22735 thiol oxidoreductase (Pseudomonas simiae WCS417)
MLRSLFRLSAALLALSLTACDDAPRFTKAEPGEARAGGAATVNKRDQNAFSLPSANLSPT
RRLDFSVGNSFFRSPWVIAPSTTTARDGLGPLFNTNACQNCHIKDGRGHPPLPDAPNAVS
MLVRLSIPDAAPYAKLIEQVGVVPEPVYGGQLQDMAVPGVTPEGKVRVDYTPVNVTFKDG
TVVELRKPDLQITQLGYGPMHPDTRFSARIAPPMIGLGLLEAISDADILRNTDPKTADKA
AIVGRANWVWDDAQQKTVLGRFGWKAGQPNLNQQNVHAFSGDMGLTTTLRPFDDCTDAQV
ACKQAPNGNGPDGEPEVSDNILRLVLFYTRNLAVPARRGVNTPQVLAGKTLFYQAGCQGC
HTPAFTTAANAAEPELANQVIRPYSDLLLHDMGDGLADNRSEFKAGGRDWRTPPLWGIGL
TQTVSGHTQFLHDGRARNLLEAVLWHGGEAQAAQQQVLSFNAEQRAALLAFLNSL