Protein Info for GFF4440 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Conjugative transfer protein TrbL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 transmembrane" amino acids 29 to 48 (20 residues), see Phobius details amino acids 69 to 92 (24 residues), see Phobius details amino acids 140 to 165 (26 residues), see Phobius details amino acids 172 to 172 (1 residues), see Phobius details amino acids 174 to 191 (18 residues), see Phobius details amino acids 209 to 229 (21 residues), see Phobius details amino acids 241 to 262 (22 residues), see Phobius details amino acids 277 to 305 (29 residues), see Phobius details TIGR02783: P-type conjugative transfer protein TrbL" amino acids 1 to 306 (306 residues), 213.5 bits, see alignment E=2.1e-67 PF04610: TrbL" amino acids 37 to 257 (221 residues), 176.3 bits, see alignment E=4e-56

Best Hits

KEGG orthology group: K07344, type IV secretion system protein TrbL (inferred from 89% identity to rpi:Rpic_2650)

Predicted SEED Role

"Conjugative transfer protein TrbL" in subsystem Type 4 secretion and conjugative transfer

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (453 amino acids)

>GFF4440 Conjugative transfer protein TrbL (Hydrogenophaga sp. GW460-11-11-14-LB1)
MNDVTVIDRFLDTFSRYIDSGFGLLQGEVAFLTATLIVIDMTLAGLFWAMGHATGQGEDV
IAKLLRKVLYVGAFAYIIGNFNGLAGIVFRSFAGLGLTASGSTLSMGNFLQPGRLAKVGI
DAAAPILDQIREMAGFPEVFIHIAPIVVLFLAWLVVIVSFFVLAVQLFVTLIEFKLTTLA
GFVLVPFALWNKTAFLAEKVLGNVVSSGIKVLVLAVIVGIGSGLFAEFRIPPGSEPSIDQ
ALVIMLASLSMLALGIFGPGIATGLVSGGPQLGAGAMAGAAIGAAGTAVAVGAAATGVGS
AVAAGARMAPAAAKMAGNGARSMASTAGSAKSAYQAGSTSAGGGLKGAAAGVGNVAKTGA
QVAGQKVADGARSMKDRVAAAFRPDDAGSAPGAGAQNTSEAAASPPSTEQPAWAKRLHRR
QQLTHAATTAAHTLRGGDGGSSSQGPSLRDSDS