Protein Info for GFF4440 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: UDP-2,3-diacylglucosamine diphosphatase (EC 3.6.1.54)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01854: UDP-2,3-diacylglucosamine diphosphatase
  • amino acids 3 to 231 (229 residues), 368.4 bits, E=6e-115
• PF00149: Metallophos
  • amino acids 4 to 199 (196 residues), 39 bits, E=1.2e-13

Best Hits

Swiss-Prot: 100% identical to LPXH_SALNS: UDP-2,3-diacylglucosamine hydrolase (lpxH) from Salmonella newport (strain SL254)

KEGG orthology group: K03269, UDP-2,3-diacylglucosamine hydrolase [EC: 3.6.1.-] (inferred from 96% identity to sea:SeAg_B0581)

MetaCyc: 84% identical to UDP-2,3-diacylglucosamine diphosphatase (Escherichia coli K-12 substr. MG1655)
LIPIDXSYNTHESIS-RXN [EC: 3.6.1.54]

Predicted SEED Role

"UDP-2,3-diacylglucosamine diphosphatase (EC 3.6.1.54)" (EC 3.6.1.54)

MetaCyc Pathways

• superpathway of Kdo₂-lipid A biosynthesis (23/25 steps found)
• superpathway of (Kdo)₂-lipid A biosynthesis (17/17 steps found)
• lipid IV_A biosynthesis (P. gingivalis) (9/9 steps found)
• lipid IV_A biosynthesis (E. coli) (6/6 steps found)
• lipid IV_A biosynthesis (H. pylori) (6/6 steps found)
• lipid IV_A biosynthesis (P. putida) (6/6 steps found)
• lipid IV_A biosynthesis (Vibrio cholerae serogroup O1 El Tor) (6/6 steps found)
• lipid IV_A biosynthesis (generic) (6/6 steps found)
• lipid IV_A biosynthesis (2,3-diamino-2,3-dideoxy-D-glucopyranose-containing) (5/6 steps found)

KEGG Metabolic Maps

• Folate biosynthesis
• Lipopolysaccharide biosynthesis
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.- or 3.6.1.54

Protein Sequence (240 amino acids)

>GFF4440 UDP-2,3-diacylglucosamine diphosphatase (EC 3.6.1.54) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
VATLFIADLHLQTEEPAIVAGFLRFLAVEARQADALYILGDLFEAWIGDDDPNPLHREMA
VAIKSLVDSGVPCFFIHGNRDFLIGKRFARESGMILLPQEKVLDLYGRNVLIMHGDTLCT
DDAGYQAFRAKVHNPWVQRLFLTLPLFIRRRIAARMRAGSKAANSSKSLDIMDVNAQTVV
AEMEKHRVQWLIHGHTHRPAVHELSANDQPAFRVVLGAWHHEGSMVKVTPDNVELIAFPL