Protein Info for GFF444 in Variovorax sp. SCN45

Annotation: Cob(I)alamin adenosyltransferase (EC 2.5.1.17) @ Cob(I)alamin adenosyltransferase (EC 2.5.1.17), clustered with cobalamin synthesis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 189 TIGR00708: cob(I)yrinic acid a,c-diamide adenosyltransferase" amino acids 18 to 188 (171 residues), 199.9 bits, see alignment E=1.4e-63 PF02572: CobA_CobO_BtuR" amino acids 20 to 188 (169 residues), 210 bits, see alignment E=1.5e-66

Best Hits

Swiss-Prot: 46% identical to BTUR_ECOLI: Corrinoid adenosyltransferase (btuR) from Escherichia coli (strain K12)

KEGG orthology group: K00798, cob(I)alamin adenosyltransferase [EC: 2.5.1.17] (inferred from 97% identity to vpe:Varpa_3373)

Predicted SEED Role

"Cob(I)alamin adenosyltransferase (EC 2.5.1.17)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 2.5.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.17

Use Curated BLAST to search for 2.5.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (189 amino acids)

>GFF444 Cob(I)alamin adenosyltransferase (EC 2.5.1.17) @ Cob(I)alamin adenosyltransferase (EC 2.5.1.17), clustered with cobalamin synthesis (Variovorax sp. SCN45)
MQIETPPSEKPYEKPEGERRGIVIVNTGDGKGKSTAAFGLALRAHGRGKAVKIYQFMKVP
TARFGEHRMFEQIGIPIEGLGDGFSWKSQDLERSGQLARDGWEKAKAAIMSGEFFLVVLD
EITYPLIYGWLPLDGVLETLRARPRHVHVVLTGRRCPPEIIELADTVTEMTLVKHAFKAG
IPAQRGIED