Protein Info for GFF444 in Pseudomonas sp. DMC3

Annotation: Protein phosphatase PrpC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 PF13672: PP2C_2" amino acids 19 to 204 (186 residues), 48.5 bits, see alignment E=1.3e-16 PF00481: PP2C" amino acids 31 to 154 (124 residues), 41.5 bits, see alignment E=1.9e-14

Best Hits

KEGG orthology group: K11915, serine/threonine protein phosphatase Stp1 [EC: 3.1.3.16] (inferred from 98% identity to pfo:Pfl01_5576)

Predicted SEED Role

"Protein serine/threonine phosphatase PrpC, regulation of stationary phase" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (242 amino acids)

>GFF444 Protein phosphatase PrpC (Pseudomonas sp. DMC3)
MLVASPWRSAARTDPGKVRARNEDAFLDSPQHGLWVVADGMGGHQGGDIASQLIVASLAE
LPQHEDFDERLKAIRQCLHWLNRRLGQELTVTAGRHDSIMGSTVVALLVEGNRAACIWAG
DSRCYMWRGQRLYQLSKDHSLQQQLIDEQQMSVEQAAAHPAAQALTRAVGAADTLTLDVL
ELEVYPGDVFLLCSDGLYQGLSSDALGNALSLSAPHVALERLFDGALRGAARDNLTAVVI
RQ