Protein Info for GFF4438 in Variovorax sp. SCN45

Annotation: Sugar kinases, ribokinase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 PF00294: PfkB" amino acids 34 to 290 (257 residues), 120.9 bits, see alignment E=3.7e-39

Best Hits

KEGG orthology group: K00856, adenosine kinase [EC: 2.7.1.20] (inferred from 94% identity to vpe:Varpa_1010)

Predicted SEED Role

"Sugar kinases, ribokinase family"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>GFF4438 Sugar kinases, ribokinase family (Variovorax sp. SCN45)
MAAVICGSLAFDTIMTFEGRFADQILPDQLHILNVSFLVPTLRRDFGGCAGNIAYSLNAL
GGTALPMATLGSDGASYLERMRSLGISTEFVRQLDDTFTAQAMIMSDVDNNQITAFHPGA
MQQAHVTKVAAREDIKLGIIAPDGRDAMLQHAEQFAAAGIPFVFDPGQGLPMFDGEALRH
FVELASWVVVNDYEGKMLSQRTGWSLAEISQRVRGLVVTLAADGCEVWTDGVREHVPGVV
PTEVVEPTGCGDAWRGALLFGLEKEWPLAQCAALGNRIGALKIAQRGPQNYQVDRKALGL