Protein Info for PS417_22715 in Pseudomonas simiae WCS417

Annotation: heme oxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 PF01126: Heme_oxygenase" amino acids 14 to 192 (179 residues), 68.3 bits, see alignment E=4.3e-23

Best Hits

KEGG orthology group: K07215, heme oxygenase (inferred from 96% identity to pfs:PFLU4969)

Predicted SEED Role

"Heme oxygenase HemO, associated with heme uptake" in subsystem Heme, hemin uptake and utilization systems in GramPositives or Hemin transport system or Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U1UW02 at UniProt or InterPro

Protein Sequence (202 amino acids)

>PS417_22715 heme oxygenase (Pseudomonas simiae WCS417)
MTASPTAERPSLRSQRLNQITHSPHAKLDALVKAHAPFETQANFARFVVAQYLFQSELVA
LYNDAELIKIVPDLPERCRAEAAKLDLGDLDTEVPAPVAGAVNNPSKAEALGWLFVSEGS
KLGAAFLIKRAVGLGLSETFGARHLGEPAGGRAEGWKRFTRTLDALEFSAEEEAAVEKGA
IDAFVRFTVLLEQAYASAPELA