Protein Info for GFF4437 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Carbamate kinase (EC 2.7.2.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF00696: AA_kinase" amino acids 2 to 277 (276 residues), 88 bits, see alignment E=4.1e-29 TIGR00746: carbamate kinase" amino acids 2 to 296 (295 residues), 397.8 bits, see alignment E=1.4e-123

Best Hits

Swiss-Prot: 87% identical to ARCC_ECOLI: Carbamate kinase (arcC) from Escherichia coli (strain K12)

KEGG orthology group: K00926, carbamate kinase [EC: 2.7.2.2] (inferred from 99% identity to sed:SeD_A0580)

Predicted SEED Role

"Carbamate kinase (EC 2.7.2.2)" in subsystem Arginine Deiminase Pathway or Arginine and Ornithine Degradation or MLST or Polyamine Metabolism (EC 2.7.2.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.2.2

Use Curated BLAST to search for 2.7.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (297 amino acids)

>GFF4437 Carbamate kinase (EC 2.7.2.2) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKTLVVALGGNALLQRGEALTAENQYRNIADAVPALARLARSYRLAIVHGNGPQVGLLAL
QNLAWKAVEPYPLDVLVAESQGMIGYMLAQRLALEPDMPPVTAVLTRIKVSADDPAFLEP
EKFIGPVYSPEEQMALEATYGWHMKRDGKYLRRVVASPAPRQIIESAAIELLLKEGHVVI
CSGGGGVPVAGEGEGVEAVIDKDLAAALLAEQIAADGLIILTDADAVYEHWGTPQQRAIR
QASPDELAPFAKADGAMGPKVTAVSGYVKRCGKPAWIGALSRIDDTLAGRAGTCICL