Protein Info for PS417_22710 in Pseudomonas simiae WCS417

Annotation: TonB-dependent receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 854 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details PF07660: STN" amino acids 67 to 116 (50 residues), 30.9 bits, see alignment 2.8e-11 TIGR01785: TonB-dependent heme/hemoglobin receptor family protein" amino acids 125 to 850 (726 residues), 416.6 bits, see alignment E=1.9e-128 TIGR01786: TonB-dependent hemoglobin/transferrin/lactoferrin receptor family protein" amino acids 127 to 850 (724 residues), 515.8 bits, see alignment E=1.9e-158 PF07715: Plug" amino acids 140 to 249 (110 residues), 93.4 bits, see alignment E=1.8e-30 PF00593: TonB_dep_Rec_b-barrel" amino acids 340 to 808 (469 residues), 228.8 bits, see alignment E=3.7e-71

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 88% identity to pfs:PFLU4968)

Predicted SEED Role

"TonB-dependent hemin , ferrichrome receptor" in subsystem Hemin transport system or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UEH4 at UniProt or InterPro

Protein Sequence (854 amino acids)

>PS417_22710 TonB-dependent receptor (Pseudomonas simiae WCS417)
MSSRFNRRSSSPTLSLLTAAILLAAAPVMTATAAEPAARSHGNYSFSIEQQPLVSALNAF
TAVTGWQVGLPAELGQGVSSPGVRGPLSPEKALDRLLVGTNLSYRKLGNNNIVLEKRAPG
GALNLQQVTISATRNEQNINSVPSTVTVQEREALDRQNVNTIRELVRYEPNVSVGGAGGR
SSNSGYNIRGIDGDRILTQVDGVEVPDNFFNGPYAKTRRNYVDPEIVKRVEILRGPASAL
YGSSAIGGAVSYFTLDPDDIIKPGQDVGARLKTGYSSADESWLTSGTVAGRVQDVDGLLH
LSQRNGHEMESYDGNNATGLARTGANPEDARTTNVLAKLGWNYGDDNRLGLTYEKYKDDR
DVNLKNAVGGPFTGGRGFNFYRARSGNDTITRERFAIENRFALDSPIADQIKTSLNYQIA
KTDQSTAEIYQPSRRVLRTRETLYEEKQWVFDAQLDKAFSWGDTDHQVTYGTTLKQQKVT
GSREGAATCLAVGGGCTAIGAPSPTASDSVKKASDFPDPTINTYSLFAQDQITWDKWTFL
PAVRYDYTQLKPKLTEEFLNTVDPTRIYAHSDKEKTWHRVTPKFGLTYALTDQYTWFGQY
AEGFRTPSAKALYGRFENLQQGYTVEPNPNLKPESSKGVETGIRGHFDSGSFDIAVFYNK
YRNFIDEDASVAGGTAQQFEANNIKHATIKGIEAKGRLNLDAFGAPQGLYTQGSVGYTYG
RNDDNGEPLNSVNPLKGVFGLGYDKDNYGGLLSWTLVKKQDRVDSTTFHAPDGSTTAPFK
TPGFGVLDLTAFYKVTNDVTVNGGLYNLTDKKYWNWDDVRSYDGVGEAGVTSPANLDRLT
QPGRNVAINVIWDI