Protein Info for GFF4435 in Xanthobacter sp. DMC5

Annotation: Hydrogenase maturation factor HybF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00100: hydrogenase nickel insertion protein HypA
  • amino acids 1 to 112 (112 residues), 101.5 bits, E=1.5e-33
• PF01155: HypA
  • amino acids 1 to 112 (112 residues), 111 bits, E=1.6e-36

Best Hits

Swiss-Prot: 90% identical to HYPA_XANP2: Hydrogenase maturation factor HypA (hypA) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K04651, hydrogenase nickel incorporation protein HypA (inferred from 90% identity to xau:Xaut_2182)

MetaCyc: 41% identical to hydrogenase 3 nickel incorporation protein HypA (Escherichia coli K-12 substr. MG1655)
RXN-22650

Predicted SEED Role

"[NiFe] hydrogenase nickel incorporation protein HypA" in subsystem NiFe hydrogenase maturation

MetaCyc Pathways

• NiFe(CO)(CN)₂ cofactor biosynthesis (5/10 steps found)

Protein Sequence (113 amino acids)

>GFF4435 Hydrogenase maturation factor HybF (Xanthobacter sp. DMC5)
MHEMAVCESLLSAMEEAAKAQNFSRVTRVRLAIGRFAGIEVEALRFGFDVVTRGSLADGA
ELVVLEEEGTAWCFDCSDTVPLAHRLAPCPKCGGERLVPNGGTEMKIKDLEVM