Protein Info for PS417_22705 in Pseudomonas simiae WCS417

Annotation: glycerol-3-phosphate ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 transmembrane" amino acids 94 to 112 (19 residues), see Phobius details PF16220: DUF4880" amino acids 23 to 62 (40 residues), 34.8 bits, see alignment 1.9e-12 PF04773: FecR" amino acids 119 to 209 (91 residues), 58.2 bits, see alignment E=1.4e-19 PF16344: FecR_C" amino acids 253 to 301 (49 residues), 27.1 bits, see alignment 5.3e-10

Best Hits

KEGG orthology group: None (inferred from 98% identity to pfs:PFLU4967)

Predicted SEED Role

"Iron siderophore sensor protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UMS7 at UniProt or InterPro

Protein Sequence (322 amino acids)

>PS417_22705 glycerol-3-phosphate ABC transporter substrate-binding protein (Pseudomonas simiae WCS417)
MTDPNKLRPHELAHEVLQDTAMDQALDWLIALQCPQAGQQAEFETWLASDPAHVHAFAKA
QAAWGGAPVHSAAVALAAPRKPSAWRRLKPHWKPLATAAVLLIGLFSFSNLPVRLQADHL
TVVGERQRLQLDDGSKVLLNTNSAFSSNIKDHQRIARLYQGEAFFDIVPSHGLPLEIDAG
PVRASVRDTAFAVRYLNGEAQVQVQRGDVDLSNTFDDARVRLSAGESIRIGPKGFGQPAK
LDANKDLAWVQGRLIFENCPMSEVLAELRRYYPGWIVNTNDQLASVAVTGNYRLDQPLDV
VRSLAHITSAKLSEYPSLVILN