Protein Info for GFF4434 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Protein fdrA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 554 PF02629: CoA_binding" amino acids 193 to 287 (95 residues), 42.5 bits, see alignment E=9e-15 PF00549: Ligase_CoA" amino acids 335 to 489 (155 residues), 113.8 bits, see alignment E=6.1e-37

Best Hits

Swiss-Prot: 83% identical to FDRA_ECOLI: Protein FdrA (fdrA) from Escherichia coli (strain K12)

KEGG orthology group: K02381, FdrA protein (inferred from 100% identity to stm:STM0529)

Predicted SEED Role

"Protein fdrA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (554 amino acids)

>GFF4434 Protein fdrA (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MIHAFIKKGCFQDSVSLMIISRKLSESENVDDVSVMMGTPANKSLLETTGFWHDDFHGAT
PNDICVAIRTEAVDDGITQVIVQQLEEALQQLAQGSSGSQSLIQVRRWESACQKLPEASL
ALVSVAGEYAAELAEQALDRSLNVMIFSDNVTLDDEIRLKRRARDKGLLVMGPDCGTAMI
ANTPLAFANVMPEGNIGVIGASGTGIQELCSQIALAGEGITHAIGLGGRDLSAEVGGISA
LTALEILSADEKSQVLAFVSKPPADAVRQHIIAAMKAAGKPVVALFLGFSSPVAREENVW
FASTLDEAARLACLLSRVTSQRKEMVSTGGVIRGLYTGGTLAAEAAGLLAGYLGVAADTE
HHHGMMLDADGHQIIDLGDDFYTVGRPHPMIDPALRNQLIAGLGAQPQVRVLLVDVVIGF
GATADPAASLIQAWQKACDARARDQPLFAIATVTGTERDPQCRSQQIAALEDAGITVVDS
LPEATLLAAELIRPTLSSTHPSAPRLLEAVAVINAGLRSFALDLQAAGMPVVHYQWAPVA
GGNKKLARLLERLQ