Protein Info for GFF4431 in Variovorax sp. SCN45

Annotation: Multi-sensor signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 565 transmembrane" amino acids 35 to 56 (22 residues), see Phobius details amino acids 62 to 81 (20 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 123 to 152 (30 residues), see Phobius details amino acids 168 to 187 (20 residues), see Phobius details PF25323: 6TM_PilS" amino acids 30 to 200 (171 residues), 33.3 bits, see alignment E=6e-12 PF00512: HisKA" amino acids 337 to 400 (64 residues), 53.6 bits, see alignment E=2.9e-18 PF02518: HATPase_c" amino acids 446 to 552 (107 residues), 54.2 bits, see alignment E=2.9e-18

Best Hits

KEGG orthology group: K02668, two-component system, NtrC family, sensor histidine kinase PilS [EC: 2.7.13.3] (inferred from 89% identity to vpe:Varpa_1016)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (565 amino acids)

>GFF4431 Multi-sensor signal transduction histidine kinase (Variovorax sp. SCN45)
MSSPLWSRGEPVTDWDVLELGGSESTALIRLWRGFMAARCFVALVLVMLQGVAFALGQTM
QPLAIGISAVYLVTAWLTMRYTRLQPPIRGFTAPWLLTVGIDLAAFTTLQVMQGGNVNYT
PLFALPVLMSAVLGTVVVSLGTTSTVTLLLLADAGWHWLQQPVDSSGRFVQAALTGTGLF
VVALLAHELARRLAREEAVAQRNRSSAQMQAQVNDLVIETLSEGVLVIDAEGLVHAANPA
ADAILGQGLAKLTLPFPLHAQPAWHALAALARQTFARRAPQSEEIPVAQARGAAREVRVR
TRLTPAGDRRLDSLCVMFLQDLRELEARIRTEKLAAMGRMSAAVAHEIRNPLAAITQASA
LLNEDLTDPAHRKLTSMVQHNAQRLARIVDDVLDVSRARQQRVLSLGEQVVLDPAVQVLA
EEWIRQTQRKGVQVSLDAAGSDVRFDAEHLRRLLVNLLDNAARYAGKREGSIQVLTSLQR
GTSGRPALMVWSDGAPLEPAVQRHLFEPFFSSESRSSGLGLFLCRELCRRHGATIGYERR
ALVQGGPEGNEFFVSFAASENRLTQ