Protein Info for GFF4429 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Xanthine permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 transmembrane" amino acids 15 to 36 (22 residues), see Phobius details amino acids 43 to 63 (21 residues), see Phobius details amino acids 75 to 92 (18 residues), see Phobius details amino acids 98 to 121 (24 residues), see Phobius details amino acids 128 to 150 (23 residues), see Phobius details amino acids 170 to 189 (20 residues), see Phobius details amino acids 196 to 216 (21 residues), see Phobius details amino acids 236 to 259 (24 residues), see Phobius details amino acids 280 to 302 (23 residues), see Phobius details amino acids 318 to 364 (47 residues), see Phobius details amino acids 376 to 397 (22 residues), see Phobius details amino acids 404 to 426 (23 residues), see Phobius details PF00860: Xan_ur_permease" amino acids 8 to 393 (386 residues), 280 bits, see alignment E=1.3e-87

Best Hits

Swiss-Prot: 79% identical to YBBY_ECOLI: Putative purine permease YbbY (ybbY) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to sei:SPC_0538)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (432 amino acids)

>GFF4429 Xanthine permease (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MFPVINRESVLSGFQWFFFIFCNTVVVPPTLLSAFHLPADNLLMLTQYAFLTTALACLVQ
AFCGHRRAIMEGPTGLWWGAILTITLGEASRGTPLNDIASSLSVGIAISAMVTIFIGISG
LGHRLARLFTPAVMVFFMLLLGAQLTSIFFKGMLGLPFGIADTSARIKLAPFGLAVAVMC
FILAMIIFLQQRISRYALLVGTVVGWGLWRLCFPSSHLPPGELSWRWFPLGSHGTLMPGI
IVTAVMTGLVNISNTYGAIRGTDIFYLHQGSGSSRYRRSFMISGLMTLVTVPFAVVPFSP
FVSSIGLLTQTGDSSRKSFICGSALCLLVAIITPLTRLFCAIPLAISSAVMLVSYLPLLY
SGLVFSQQITFTARNIYRLALPLFVGIFLMGLPPVYLQDLPLMIRPLLSNGLLVGILLAV
LMENLIPWERIK