Protein Info for GFF4428 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Nitrate/nitrite transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 transmembrane" amino acids 29 to 49 (21 residues), see Phobius details amino acids 64 to 85 (22 residues), see Phobius details amino acids 96 to 115 (20 residues), see Phobius details amino acids 121 to 143 (23 residues), see Phobius details amino acids 153 to 175 (23 residues), see Phobius details amino acids 188 to 210 (23 residues), see Phobius details amino acids 255 to 276 (22 residues), see Phobius details amino acids 288 to 309 (22 residues), see Phobius details amino acids 321 to 343 (23 residues), see Phobius details amino acids 349 to 369 (21 residues), see Phobius details amino acids 381 to 402 (22 residues), see Phobius details amino acids 412 to 432 (21 residues), see Phobius details PF07690: MFS_1" amino acids 33 to 356 (324 residues), 156.3 bits, see alignment E=5e-50

Best Hits

Swiss-Prot: 42% identical to TUB3_AGRVI: Putative tartrate transporter (ttuB) from Agrobacterium vitis

KEGG orthology group: None (inferred from 46% identity to bvi:Bcep1808_2506)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (452 amino acids)

>GFF4428 Nitrate/nitrite transporter (Hydrogenophaga sp. GW460-11-11-14-LB1)
MAVTHAPNGGPITETSVEAAIFSKVNWHILPLLLVAYVFAFIDRVNIGFAQLQMKSDLHL
SDHVFALGAGLFFVGYFLFEVPSNLFLEKVGARKTILRIMLCWGACATLMAWVTAPWQFY
VLRFLLGAFEAGFFPGVILYFTYWYPSTRRGRAIAIFMTATALAGVIVGPLNGALMKFGE
GFMGMHGWQWMFIANGAPCLVVAFMVYFMLSDTPAQARWLTDEQKKILIRRVESEKITTG
RTHSAMKDLLSDPKIFALALIYFLMSAAVYALLFWAPTLIRSWGVTDVFHVGLLKAIPSV
IGMIGMVLIGRSSDRMNDRRWHFVFAMCCITVGLGTIAMLAPGLVVSLSLYSLAIIGTSA
STPLFFAFISEYLPKETAAGGIALISSLGNLGPAISPSISTWILTSTGDNKYSLMFIVAM
YALAGIFMVLAARKGAAASAVRSRSNDAQQPV