Protein Info for GFF4426 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Probable metabolite transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 52 to 74 (23 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 139 to 162 (24 residues), see Phobius details amino acids 173 to 192 (20 residues), see Phobius details amino acids 219 to 241 (23 residues), see Phobius details amino acids 259 to 278 (20 residues), see Phobius details amino acids 290 to 309 (20 residues), see Phobius details amino acids 316 to 339 (24 residues), see Phobius details amino acids 351 to 372 (22 residues), see Phobius details amino acids 382 to 404 (23 residues), see Phobius details PF07690: MFS_1" amino acids 24 to 367 (344 residues), 176.8 bits, see alignment E=1.2e-55 amino acids 228 to 405 (178 residues), 72.9 bits, see alignment E=4.9e-24 PF11700: ATG22" amino acids 352 to 409 (58 residues), 26.7 bits, see alignment E=4.6e-10

Best Hits

KEGG orthology group: None (inferred from 99% identity to sek:SSPA2046)

Predicted SEED Role

"Probable metabolite transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (415 amino acids)

>GFF4426 Probable metabolite transport protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSETKKSGIDYWKQIVVVMSLGWVAIWIYRTVLTPIYPEIQASLDNVSNAEIGAIASFYF
FAYCSMQIPCGILVDKFGQKIMLMAGFTLFIIGTLCIAKANGLTMIYIGSLMAGGGCASF
FSSAYSLSSANVPQARRALANAIINSGSAIGMGIGLIGSSILVKNMSMAWQNVLYIVAAI
LVIMLCVFTLIIRGKAKSDSAQAEKQTQTVTEDEKRAPLFSGLLCSVYFLYFCTCYGYYL
IVTWLPSYLQTERGFDGGAIGLASALVAVVGVPGALFFSHLSDKFRNSKVKVILGLEIVA
AAMLAFTVLSPNTTMLMVSLTLYGLLGKMAVDPILISFVSEQASAKSLGRAFSLFNFFGM
SSAVVAPTLTGFISDVTGSKEISFVISACLVVTGTLIFAVVTLYKKKATQRIASA