Protein Info for GFF4425 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: 2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR01505: 2-hydroxy-3-oxopropionate reductase" amino acids 2 to 291 (290 residues), 495.1 bits, see alignment E=3e-153 PF03807: F420_oxidored" amino acids 2 to 93 (92 residues), 28.5 bits, see alignment E=2.9e-10 PF03446: NAD_binding_2" amino acids 2 to 160 (159 residues), 168.1 bits, see alignment E=2.5e-53 PF14833: NAD_binding_11" amino acids 163 to 283 (121 residues), 138.6 bits, see alignment E=1.9e-44

Best Hits

Swiss-Prot: 92% identical to GLXR_ECOLI: 2-hydroxy-3-oxopropionate reductase (glxR) from Escherichia coli (strain K12)

KEGG orthology group: K00042, 2-hydroxy-3-oxopropionate reductase [EC: 1.1.1.60] (inferred from 99% identity to stt:t2341)

MetaCyc: 92% identical to tartronate semialdehyde reductase 2 (Escherichia coli K-12 substr. MG1655)
1.1.1.60,4.1.1.M27,4.1.1.73 [EC: 1.1.1.60, 4.1.1.73, 4.1.1.M27]

Predicted SEED Role

"2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60)" in subsystem Allantoin Utilization or D-galactarate, D-glucarate and D-glycerate catabolism or Photorespiration (oxidative C2 cycle) (EC 1.1.1.60)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.60

Use Curated BLAST to search for 1.1.1.60 or 4.1.1.73 or 4.1.1.M27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (292 amino acids)

>GFF4425 2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKLGFIGLGIMGSPMAINLARAGHQLHVTTIGPVADELLSLGAVNVETARQVTEFADIIF
IMVPDTPQVEDVLFGEHGCAKTSLQGKTIVDMSSISPIETKRFAQRVNEMGADYLDAPVS
GGEIGAREGTLSIMVGGEQKVFDRVKPLFDILGKNITLVGGNGDGQTCKVANQIIVALNI
EAVSEALVFASKAGADPVRVRQALMGGFASSRILEVHGERMINRTFEPGFKIALHQKDLN
LALQSAKALALNLPNTATCQELFNTCAANGGSQLDHSAMVQALELMANHKLS