Protein Info for GFF4417 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Methionine ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 PF00005: ABC_tran" amino acids 23 to 170 (148 residues), 129.8 bits, see alignment E=1.6e-41 PF09383: NIL" amino acids 261 to 335 (75 residues), 73.3 bits, see alignment E=1.8e-24

Best Hits

Swiss-Prot: 100% identical to METN2_SALTY: Methionine import ATP-binding protein MetN 2 (metN2) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02071, D-methionine transport system ATP-binding protein (inferred from 99% identity to seg:SG0522)

MetaCyc: 48% identical to L-methionine/D-methionine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN0-4522 [EC: 7.4.2.11]; 7.4.2.11 [EC: 7.4.2.11]; TRANS-RXN-383 [EC: 7.4.2.11]; TRANS-RXN0-510 [EC: 7.4.2.11]; TRANS-RXN0-511 [EC: 7.4.2.11]

Predicted SEED Role

"Methionine ABC transporter ATP-binding protein" in subsystem Methionine Biosynthesis or Methionine Degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (338 amino acids)

>GFF4417 Methionine ABC transporter ATP-binding protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MIEIEKVCVDFTAGRGTPTRAVDDVSLHIAAGEIFGIVGTSGAGKSTLLRTLNALTRPSQ
GRVNVNGVEISALDGKALRQARQRIGMIFQHFNLMHTRTVAQNVAFSLKAAGWERSKIAP
RVAEILTLVGLADKANRFPVQLSGGQKQRVGIARAIANHPDVLLCDEPTSALDLETSATI
LALLRQINAQLGITIVLITHEMNVIKSICDRVAVMSGGKVVESGEVFDVFAHPQHAFTQQ
LVSHTLNLTLPERLREHLPGQLLKILFIGDSAEQPVLSEVAIKFGVAVNILHGKIEYIGE
RALGILVVQLTAPHNPTAVAAAVEHIRQRTAQVEVIRG