Protein Info for PS417_22605 in Pseudomonas simiae WCS417

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 36 to 55 (20 residues), see Phobius details PF01882: DUF58" amino acids 199 to 284 (86 residues), 96.1 bits, see alignment E=1.2e-31 PF13519: VWA_2" amino acids 241 to 344 (104 residues), 28.6 bits, see alignment E=1.8e-10

Best Hits

KEGG orthology group: None (inferred from 91% identity to pfs:PFLU4946)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UMR0 at UniProt or InterPro

Protein Sequence (443 amino acids)

>PS417_22605 membrane protein (Pseudomonas simiae WCS417)
MKPTRLLLNWLGVLLGVGILLGTASALQFKVPDTLHSIAWGLLLALLLLALLDAMRLRSR
PSPRVQRQMPGSLALGRWGDIRLAIEHDFRQPLSVQVFDHVPDGLSVEHMPQSIALRPGE
RSELGYRLRPMRRGHFSFSRCELHLPSPMGLWSARRLIEVSDTTRVYPDFARLYGAQLLG
VDNWLNQLGVRQHQRRGLGLEFHQLREFREGDSLRQIDWKATARQRTPIAREYQDERDQQ
IVFMLDCGRRMRSQDDELSHFDHALNACLLLSYVALRQGDAVGLCTFAADLPRYLAPVKG
SSQLNLLLNAVYDLDTTRRTADYQAAASQLLARQKRRALVIVVTNLRDEDDETLLAAVKR
ISRQHRVLVVSLREEALDRLRQAPVQTLPEALAYSGTIDYLNARNELHDRLSAQGLSLLD
SLPSELGPALITRYLGWKKAGVL