Protein Info for PS417_22590 in Pseudomonas simiae WCS417

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 509 transmembrane" amino acids 31 to 66 (36 residues), see Phobius details amino acids 151 to 175 (25 residues), see Phobius details amino acids 205 to 228 (24 residues), see Phobius details amino acids 249 to 268 (20 residues), see Phobius details amino acids 350 to 370 (21 residues), see Phobius details PF13559: DUF4129" amino acids 429 to 500 (72 residues), 27.8 bits, see alignment E=1.1e-10

Best Hits

KEGG orthology group: None (inferred from 85% identity to pfs:PFLU4943)

Predicted SEED Role

"5'-nucleotidase/2',3'-cyclic phosphodiesterase and related esterases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U1UW24 at UniProt or InterPro

Protein Sequence (509 amino acids)

>PS417_22590 membrane protein (Pseudomonas simiae WCS417)
MRLSDASVVIRPRTAWEAMDLGVLMAREHCLLLMGSWALVTLPVFAVLTALLWKYPTTAI
LVFWWLKPAFDRLPLYILSKALFGETPSIKQAVRQWPRLLKGQLLASLTWRRLSLSRSFV
MPVSQLEGLDGPTRQKRLGVLQQRSAGAARWLTTIGVHLEIGLWFGCMTLFYLFIPQNIE
LDWDWQRLILATSSEGLWLEHLSNVFYALILVFWEPIYVACGFSLYLNRRTVLEAWDLEL
VFRRLRQRLSNVAPLLVLMIGLTLLPFSPPVMAASSPPKKPLTTQGASQSIKSLLEKPPF
KNPETVTRYRFGEDKPSVKNKTHRDGKLPDWLKALLDNLNSNTFKHIAQGLEVLLWGLMV
GALIMLVWRYREWLRTFVSRRGPRKPQNVKPAPTQLFGLELGSETLPDDIASAAERLWPT
QPREALGLLYRGLLSRLLHDFNVPLKSADTEGQILERVNQLQQPRLLAFSNELTHHWQNL
AYGHCLPPPSAQQQLCSDWRTLFNVGSNP