Protein Info for GFF4405 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 PF00872: Transposase_mut" amino acids 10 to 371 (362 residues), 419 bits, see alignment E=1.7e-129 PF10551: MULE" amino acids 158 to 254 (97 residues), 28.7 bits, see alignment E=1.5e-10

Best Hits

Swiss-Prot: 45% identical to TRA1_MYCTU: Transposase for insertion sequence element IS1081 (Rv1199c) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 98% identity to swi:Swit_4911)

Predicted SEED Role

"Transposase, mutator type"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (403 amino acids)

>GFF4405 hypothetical protein (Sphingobium sp. HT1-2)
MTDDRLPLAELMAKTGDGDFLRTIAESVLQIIMEADVDGLVGAGRHERSGERTTWRNGYR
DRSLDTRLGTLNLKIPKLRTGAYFPGFLEPRKTVEKALVAVIQEAWIAGVSTRRVDELVQ
AMGMTGISKSSVSKLCKDIDERVHAFLKRPLAGDWPYLWLDATYLKVREGGRIVSVAAII
AVAVNTEGKREIVGLHIGPSEAEPFWSSFLKDLSRRGLTGVKLVISDAHEGLKAAITRVL
SATWQRCRVHFMRNALAYVPKGQNTVVAAAIRQVFLQPDHAAATQVWRQVADQLRARWPK
LGACMDDAEHDVLAYMTFPEQHRVKLHSTNPLERLNKEVKRRADVVGIFPNEDSIIRLVG
AVLLEQNDEYQLQHRYMQIEGMAALATPITEEVQPLQITPKAA