Protein Info for PS417_22540 in Pseudomonas simiae WCS417

Annotation: preprotein translocase subunit SecA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 911 PF07517: SecA_DEAD" amino acids 6 to 401 (396 residues), 437.2 bits, see alignment E=8.5e-135 TIGR00963: preprotein translocase, SecA subunit" amino acids 28 to 818 (791 residues), 1098.6 bits, see alignment E=0 PF00270: DEAD" amino acids 96 to 216 (121 residues), 25.8 bits, see alignment E=2.4e-09 PF01043: SecA_PP_bind" amino acids 232 to 358 (127 residues), 121.6 bits, see alignment E=7e-39 PF21090: P-loop_SecA" amino acids 417 to 614 (198 residues), 295.8 bits, see alignment E=4.9e-92 PF07516: SecA_SW" amino acids 617 to 830 (214 residues), 241.3 bits, see alignment E=3e-75 PF02810: SEC-C" amino acids 891 to 908 (18 residues), 35.6 bits, see alignment (E = 2e-12)

Best Hits

Swiss-Prot: 82% identical to SECA_AZOVD: Protein translocase subunit SecA (secA) from Azotobacter vinelandii (strain DJ / ATCC BAA-1303)

KEGG orthology group: K03070, preprotein translocase subunit SecA (inferred from 82% identity to avn:Avin_13340)

Predicted SEED Role

"Protein export cytoplasm protein SecA ATPase RNA helicase (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UGQ7 at UniProt or InterPro

Protein Sequence (911 amino acids)

>PS417_22540 preprotein translocase subunit SecA (Pseudomonas simiae WCS417)
MFAPLLKKLFGSKNEREVKRMLKTVQLVNAFEEQMVALSDEQLRAKTQEFKARIAKGETL
DKLLPEAFAVAREAGKRVMGMRHFDVQLIGGMTLHEGMIAEMRTGEGKTLVATLGVYLNA
LSGKGVHVVTVNDYLARRDANWMRPLYEFLGLTVGVVTPFQPPEEKRAAYAADITYGTNN
EFGFDYLRDNMAFSMEEKFQRELNFAVIDEVDSILIDEARTPLIISGQAEDSSRLYTEIN
KLIPRLEQHIEEVEGVVTKEGHFSIDEKTRQVELNEAGHQFVEEMLTQIGELAEGESLYS
AHNLGLLTHVYAGLRAHKLFHRNVEYIVQDGQVVLVDEHTGRTMPGRRLSEGLHQAIEAK
ENLNIQAESQTLASTTFQNYFRLYNKLSGMTGTADTEAFEFHQIYNLAVMVIPPNKPLAR
KDFNDLVFLTAEEKYAAIINDIKDGMAQGRPILVGTATIETSEHVSNLLNKEGIEHKVLN
AKFHEKEAEIIAQAGRPGALTIATNMAGRGTDILLGGNWEVEVAALENPSPEQIAQIKAD
WQKRHQAVLESGGLQVIASERHESRRIDNQLRGRAGRQGDAGSSRFYLSLEDSLMRIFAS
DRVKNFMKALGMQSGEAIEHRMVTNAIEKAQRKVEGRNFDIRKQLLEFDDVNNEQRKVIY
HMRNTLLAADNIGETIADFRQDVLNATVSAHIPPQSLPEQWDVAGLEAALKSDFGVDLPV
QQWLDEDDHLYEETLREKLMAELLAAYNEKEEQASAEALRTFEKQIVLRVLDDLWKDHLS
TMDHLRHGIHLRGYAQKNPKQEYKRESFTLFSELLDSIKRDSIRVLSHVQVRREDPIEEE
ARLRQEAEALAARMQFQHDEAPGLEAPEVLGEEVDVALAQTPVRNDQKLGRNELCYCGSG
KKFKHCHGQIE