Protein Info for GFF44 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Outer membrane protein H precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF03938: OmpH" amino acids 23 to 159 (137 residues), 89 bits, see alignment E=1.7e-29

Best Hits

Swiss-Prot: 99% identical to SKP_SALPA: Chaperone protein Skp (skp) from Salmonella paratyphi A (strain ATCC 9150 / SARB42)

KEGG orthology group: K06142, outer membrane protein (inferred from 99% identity to sei:SPC_0241)

MetaCyc: 90% identical to periplasmic chaperone Skp (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (161 amino acids)

>GFF44 Outer membrane protein H precursor (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
VKKWLLAAGLGLAMVTSAQAADKIAIVNMGNLFQQVAQKTGVSNTLENEFKGRAAELQKM
ETDLQSKMQRLQSMKAGSDRTKLEKDVMSQRQTFAQKAQAFEKDRARRSNEERNKLVTRI
QTAVKKVANDQSIDLVVDANTVAYNSSDVKDITADVLKQVK