Protein Info for PS417_22510 in Pseudomonas simiae WCS417

Annotation: nucleotide-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 PF04461: YajQ" amino acids 2 to 160 (159 residues), 207.7 bits, see alignment E=6e-66

Best Hits

Swiss-Prot: 98% identical to Y4927_PSEFS: UPF0234 protein PFLU_4927 (PFLU_4927) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K09767, hypothetical protein (inferred from 98% identity to pfs:PFLU4927)

Predicted SEED Role

"FIG001943: hypothetical protein YajQ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U3A6 at UniProt or InterPro

Protein Sequence (161 amino acids)

>PS417_22510 nucleotide-binding protein (Pseudomonas simiae WCS417)
MPSFDVVSELDKHEVTNAVENAVKELDRRYDLKGKGSFEFKEKELTVNLTAEADFQLEAM
IEILKLSLVKRKIDAQCLEIKDAYASGKLMKQEAILKEGIDKELAKKIVAHIKDAKLKVQ
AAIQGEQVRVTGKKRDDLQEAIAALRAKTFDMPLQFNNFRD