Protein Info for PS417_22505 in Pseudomonas simiae WCS417

Annotation: mechanosensitive ion channel protein MscS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 transmembrane" amino acids 25 to 45 (21 residues), see Phobius details amino acids 66 to 90 (25 residues), see Phobius details amino acids 93 to 124 (32 residues), see Phobius details PF05552: MS_channel_1st_1" amino acids 17 to 59 (43 residues), 23.6 bits, see alignment 5.7e-09 PF00924: MS_channel_2nd" amino acids 111 to 177 (67 residues), 75.2 bits, see alignment E=5.5e-25 PF21082: MS_channel_3rd" amino acids 183 to 264 (82 residues), 59.7 bits, see alignment E=4.8e-20

Best Hits

Swiss-Prot: 42% identical to MSCS_EDWI9: Small-conductance mechanosensitive channel (mscS) from Edwardsiella ictaluri (strain 93-146)

KEGG orthology group: K03442, small conductance mechanosensitive channel (inferred from 95% identity to pfs:PFLU4926)

MetaCyc: 36% identical to small conductance mechanosensitive channel MscS (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-86

Predicted SEED Role

"Small-conductance mechanosensitive channel"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UED8 at UniProt or InterPro

Protein Sequence (280 amino acids)

>PS417_22505 mechanosensitive ion channel protein MscS (Pseudomonas simiae WCS417)
MDLNAEVDHLIKTSESWLPMIMEYGSRFLLAVVTLAIGWWLINVLTHRVGRLLALRNADL
ALQHFITSLANIALKVMLVVNVASMIGVATTSFVAAIGAATLAIGLALQGSLANFAGGVL
ILLFRPFRIGDWIEAQGTSGTVDSIQIFHTVLRTGDNKTVIIPNGSLSNGLITNTNRQPT
RKVVFDVGVDYEADLQKAREVLLELAKDPRVLADPAAVAVVSTLGDSSITVSLRCWTKTA
DYWDVVFMLNELARDRLKAAGIDIPFPQRVIRVMQETVAK