Protein Info for GFF4396 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: FIG00957806: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 transmembrane" amino acids 14 to 32 (19 residues), see Phobius details PF20109: DUF6499" amino acids 10 to 66 (57 residues), 29.5 bits, see alignment E=7e-11 PF10074: DUF2285" amino acids 164 to 243 (80 residues), 82.1 bits, see alignment E=4.4e-27

Best Hits

KEGG orthology group: None (inferred from 85% identity to dia:Dtpsy_1286)

Predicted SEED Role

"FIG00957806: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (260 amino acids)

>GFF4396 FIG00957806: hypothetical protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MVDPHHLAHWYPTAAYLYILWLDALALAWEYLRRHPDYRLDWLRRHRRHHIHPAAASAAH
RWGLRLLEDPALDARDAHPAWLPGHAAVVQLYPDADPPPDATAFAFWRVPGHKQLLHDGK
GLVLIARSPGHCLRFALAPGLEDGMAVAYAHRGGAAAPARGHMPGATLADTKPRPTPAAL
LELHTLQALDATQAGASLREVAEGLFGPDAVADWYSDGGLRSKVRRLVRRGHALMRGGYR
RLAQTPSPEKGRFAGSAKRP