Protein Info for GFF4393 in Pseudomonas sp. DMC3

Annotation: Cytochrome bo(3) ubiquinol oxidase subunit 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 transmembrane" amino acids 32 to 53 (22 residues), see Phobius details amino acids 72 to 94 (23 residues), see Phobius details amino acids 101 to 118 (18 residues), see Phobius details amino acids 138 to 162 (25 residues), see Phobius details amino acids 183 to 204 (22 residues), see Phobius details PF00510: COX3" amino acids 27 to 205 (179 residues), 66.1 bits, see alignment E=2.4e-22 TIGR02842: cytochrome o ubiquinol oxidase, subunit III" amino acids 28 to 206 (179 residues), 282.4 bits, see alignment E=1e-88

Best Hits

Swiss-Prot: 78% identical to CYOC_PSEPU: Cytochrome bo(3) ubiquinol oxidase subunit 3 (cyoC) from Pseudomonas putida

KEGG orthology group: K02299, cytochrome o ubiquinol oxidase subunit III [EC: 1.10.3.-] (inferred from 98% identity to pfo:Pfl01_4646)

MetaCyc: 79% identical to cytochrome bo terminal oxidase subunit III (Pseudomonas putida KT2440)
RXN0-5268 [EC: 7.1.1.3]

Predicted SEED Role

"Cytochrome O ubiquinol oxidase subunit III (EC 1.10.3.-)" in subsystem Terminal cytochrome O ubiquinol oxidase or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (207 amino acids)

>GFF4393 Cytochrome bo(3) ubiquinol oxidase subunit 3 (Pseudomonas sp. DMC3)
MSNLVTNVGHAHGDHGHDDHHHDSGEMTVYGFWLYLMTDCILFASIFAVYAVLVNNVAGG
PSGHDIFELPYVLGETALLLFSSITYGFAMLALYKGKKQAVLGWLFMTFLLGAGFIAMEI
NEFHLLISEGFGPSRSGFLSAFFTLVGTHGLHVSAGLIWMGIMMYQVNKHGLTSTNKTRL
SCLSLFWHFLDVVWICVFTVVYLMGTL