Protein Info for GFF4393 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: y4eB gene in pNGR234a homolog

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 104 PF05284: DUF736" amino acids 3 to 98 (96 residues), 123.1 bits, see alignment E=1.9e-40

Best Hits

Swiss-Prot: 54% identical to Y4EB_SINFN: Uncharacterized protein y4eB (NGR_a03910) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: None (inferred from 91% identity to dac:Daci_2730)

Predicted SEED Role

"y4eB gene in pNGR234a homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (104 amino acids)

>GFF4393 y4eB gene in pNGR234a homolog (Hydrogenophaga sp. GW460-11-11-14-LB1)
MANIGTFTADKDGFTGTLRTLTLNIKVKLVPNDKGDSEKAPDFRVQAASHDIGAAWKKTS
ETGRNYVSVTLDDPAFPATVYARLIEGEDGTHDLIWSRSKPQAA