Protein Info for GFF4388 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: DNA polymerase III subunits gamma and tau (EC 2.7.7.7)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 642 TIGR02397: DNA polymerase III, subunit gamma and tau" amino acids 3 to 356 (354 residues), 443.7 bits, see alignment E=2.7e-137 PF13177: DNA_pol3_delta2" amino acids 20 to 178 (159 residues), 147.4 bits, see alignment E=1.3e-46 PF07728: AAA_5" amino acids 42 to 149 (108 residues), 22.4 bits, see alignment E=3.7e-08 PF00004: AAA" amino acids 42 to 170 (129 residues), 42.2 bits, see alignment E=3.8e-14 PF22608: DNAX_ATPase_lid" amino acids 182 to 230 (49 residues), 83.4 bits, see alignment 2.7e-27 PF12169: DNA_pol3_gamma3" amino acids 232 to 358 (127 residues), 93.2 bits, see alignment E=4.8e-30 PF12168: DNA_pol3_tau_4" amino acids 416 to 497 (82 residues), 94.8 bits, see alignment E=1.2e-30 PF12170: DNA_pol3_tau_5" amino acids 499 to 639 (141 residues), 193.8 bits, see alignment E=5.8e-61

Best Hits

Swiss-Prot: 100% identical to DPO3X_SALTY: DNA polymerase III subunit tau (dnaX) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02343, DNA polymerase III subunit gamma/tau [EC: 2.7.7.7] (inferred from 94% identity to cko:CKO_02679)

Predicted SEED Role

"DNA polymerase III subunits gamma and tau (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (642 amino acids)

>GFF4388 DNA polymerase III subunits gamma and tau (EC 2.7.7.7) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSYQVLARKWRPQTFADVVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAK
GLNCETGITATPCGVCDNCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRF
KVYLIDEVHMLSRHSFNALLKTLEEPPAHVKFLLATTDPQKLPVTILSRCLQFHLKALDV
EQIRHQLEHILNEEHIAHEPRALQLLSRAADGSLRDALSLTDQAIASGDGQVSTQAVSAM
LGTLDDDQALSLVEAVVDANGERVMSLINEAAARGIEWEALLVEMLSLLHRIAMVQLSPA
ALGSDMAAIEQRMRELARTVPPGDLQLYYQTLLIGRKELPWAPDRRMGVEMTLLRALAFH
PRMPLPEPETPRQSFAPVAPTAVMTPPQLQQPSAPAPQTSPAPLPASTSQVLAARNQLQR
AQGVTKTKKSEPAAASRARPVNNSALERLASVSERVQARPAPSALETAPVKKEAYRWKAT
TPVVQTKEVVATPKALKKALEHEKTPELAAKLAAEAIERDPWAAQVSQLSLPKLVEQVAL
NAWKEQNGNAVCLHLRSTQRHLNSSGAQQKLAQALSDLTGTTVELTIVEDDNPAVRTPLE
WRQAIYEEKLAQARESIIADNNIQTLRRFFDAELDEESIRPI