Protein Info for PS417_22435 in Pseudomonas simiae WCS417

Annotation: protein tolQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 132 to 155 (24 residues), see Phobius details amino acids 175 to 197 (23 residues), see Phobius details TIGR02796: protein TolQ" amino acids 10 to 224 (215 residues), 304 bits, see alignment E=3.1e-95 PF01618: MotA_ExbB" amino acids 82 to 210 (129 residues), 142.1 bits, see alignment E=4.1e-46

Best Hits

Swiss-Prot: 90% identical to TOLQ_PSEAE: Tol-Pal system protein TolQ (tolQ) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03562, biopolymer transport protein TolQ (inferred from 98% identity to pfl:PFL_4761)

Predicted SEED Role

"MotA/TolQ/ExbB proton channel family protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U0W7 at UniProt or InterPro

Protein Sequence (231 amino acids)

>PS417_22435 protein tolQ (Pseudomonas simiae WCS417)
MEPTVVDHSSMWSLVSNASVVVQLVMLTLVAASVTSWVMIFQRSNLLRAGRRALESFEER
FWSGIDLSKLYRQAGSNPDPDSGVEQIFRAGFKEFSRLRQQPGVDPEAVMEGVARAMRVA
ISREEEKLEQSLPFLATVGSVSPYIGLFGTVWGIMNSFRGLAQAQQATLATVAPGIAEAL
IATAIGLFAAIPAVIAYNRFAARGENLIGRYYTFADEFQAILHRKVHTSEE