Protein Info for GFF4382 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Potassium efflux system KefA protein / Small-conductance mechanosensitive channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1000 1118 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 497 to 519 (23 residues), see Phobius details amino acids 555 to 576 (22 residues), see Phobius details amino acids 583 to 604 (22 residues), see Phobius details amino acids 628 to 645 (18 residues), see Phobius details amino acids 656 to 677 (22 residues), see Phobius details amino acids 689 to 714 (26 residues), see Phobius details amino acids 726 to 747 (22 residues), see Phobius details amino acids 793 to 818 (26 residues), see Phobius details amino acids 838 to 858 (21 residues), see Phobius details amino acids 879 to 901 (23 residues), see Phobius details amino acids 912 to 939 (28 residues), see Phobius details PF12795: MscS_porin" amino acids 48 to 287 (240 residues), 192.2 bits, see alignment E=2.8e-60 PF12794: MscS_TM" amino acids 507 to 824 (318 residues), 326 bits, see alignment E=6.2e-101 PF21088: MS_channel_1st" amino acids 885 to 926 (42 residues), 43.1 bits, see alignment (E = 8.3e-15) PF00924: MS_channel_2nd" amino acids 928 to 993 (66 residues), 85 bits, see alignment 7.7e-28 PF21082: MS_channel_3rd" amino acids 1002 to 1084 (83 residues), 74.7 bits, see alignment 1.7e-24

Best Hits

Swiss-Prot: 89% identical to MSCK_ECOLI: Mechanosensitive channel MscK (mscK) from Escherichia coli (strain K12)

KEGG orthology group: K05802, potassium efflux system protein KefA (inferred from 92% identity to cko:CKO_02686)

MetaCyc: 89% identical to potassium dependent, small conductance mechanosensitive channel (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-86

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (1118 amino acids)

>GFF4382 Potassium efflux system KefA protein / Small-conductance mechanosensitive channel (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MLQLYKRSQHFVFITISVLIILLSCQSLAFARGQTNGDLPSKADVQNQLDTLNKQKDLSA
QDKLVQQDLIDTLATLEKIERVKEETVQLRQKVAQAPEKMRQATAALNALSDVDNDDEMR
KTLSALSLRQLELRVAQVLDDLQNSQNDLAAYNSQLVSLQTQPERVQNAMYTASQQIQQI
RNRLDGNNVGEAALRPSQQVLLQAQQALLNAQIDQQRKSLEGNTVLQDTLQKQRDYVTAN
SNRLEHQLQLLQEAVNSKRLTLTEKTAQEAISPDETARIQANPLVKQELDINHQLSQRLI
VATENGNMLMQQNIKVKNWLDRALQSERNIKEQIAVLKGSLLLSRILYQQQQTLPSADEL
EDMTNRIADLRLEQFEINQQRDALFQSDAFVDKLEEGHTSEVNDEVHDALLQVVEMRREL
LDQLNKQLGNQLMMAINLQVNQQQLMSVSKNLKAILTQQIFWVNSNRPMDWDWLKAFPQT
LKEQFSAMKITVNWQKAWPAVFIAFLAGLPLLLIAGLIRWRLKWLKAYQQKLAAAVGSLR
NDSQLNTPKAILIDLIRALPVCLIILALGLILLTMQLNISDLLWAFSKKLAMFWLVFGLC
WKVLEKEGVAIRHFGMPAQLTSHWRRQIVRISLALLPLHFWSVVAELSPLNLMDDVLGQA
VIFLNLLVITLLVWPLCRESWRDKESHGIRLVTVTILSIIPVALMVLTATGYFYTTLRLA
GRWIETVYLVIIWNLLYQTVLRGLSVAARRIAWRRALARRQNLVKEGAEGAEPQEEPTIA
LEQINQQTLRITMLLMLALFGVMFWAIWSDLITVFSYLDSITLWHYNGSEAGAAVVKSVT
MGSLLFAIIAAMVAWALIRNLPGLLEVLVLSRLNMRQGASYAITTILNYVIIAVGAMTVF
GSLGVSWDKLQWLAAALSVGLGFGLQEIFGNFVSGLIILFERPVRIGDTVTIGTYSGTVS
KIRIRATTITDFDRKEVIIPNKAFVTERLINWSLSDTTTRLVIRLGVAYGSDLEKVKRVL
LQAAMEHPKVMHDPEPAVFFTTFGASTLDHELRLYVRELRDRSHTVDELNRAIDRLCREN
DINIAFNQLEVHLHNAKGDEVTEVKRDLNGGDLAPTAS