Protein Info for PS417_22410 in Pseudomonas simiae WCS417

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF16331: TolA_bind_tri" amino acids 61 to 116 (56 residues), 34.3 bits, see alignment E=6.3e-12 TIGR02795: tol-pal system protein YbgF" amino acids 157 to 274 (118 residues), 135.9 bits, see alignment E=5e-44 PF13525: YfiO" amino acids 158 to 239 (82 residues), 25.5 bits, see alignment E=3.2e-09 PF13174: TPR_6" amino acids 161 to 190 (30 residues), 16.3 bits, see alignment (E = 3.7e-06) amino acids 196 to 226 (31 residues), 17.1 bits, see alignment 2.1e-06 amino acids 232 to 263 (32 residues), 21 bits, see alignment 1.2e-07

Best Hits

Swiss-Prot: 79% identical to CPOB_PSEPK: Cell division coordinator CpoB (cpoB) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 96% identity to pfs:PFLU4906)

Predicted SEED Role

"TPR repeat containing exported protein; Putative periplasmic protein contains a protein prenylyltransferase domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U389 at UniProt or InterPro

Protein Sequence (277 amino acids)

>PS417_22410 hypothetical protein (Pseudomonas simiae WCS417)
MRTCRRALTVLALSLAPLAVWAAVPVEDSNSGYTNSGSSYPPAGYGTNGAYAGGAATSAP
SAQGELFNQLQRMQDQIAQQQGAIEVLQNQVNQLKQEGLERYQDLDRRIGAGVQPAATPD
NSSAGGAPSAAAGGAAAGAAASQAPAASSEPGDPAKEKLYYDAAFDLIKAKDFDKASQAF
TAFLRKYPNSQYAGNAQYWLGEVNLAKGDLQGAGQAFAKVSQLYPKHAKVPDSLYKLADV
ERRLGHTDKVKGILQQVVAQYPGTSAAQLAQRDLQRL