Protein Info for GFF4374 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: LSU ribosomal protein L36p

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 44 PF00444: Ribosomal_L36" amino acids 3 to 39 (37 residues), 60.2 bits, see alignment E=8.3e-21 TIGR01022: ribosomal protein bL36" amino acids 9 to 39 (31 residues), 30.3 bits, see alignment E=1.7e-11

Best Hits

Swiss-Prot: 100% identical to RL36_SALHS: 50S ribosomal protein L36 (rpmJ) from Salmonella heidelberg (strain SL476)

KEGG orthology group: K02919, large subunit ribosomal protein L36 (inferred from 91% identity to eco:b4506)

Predicted SEED Role

"LSU ribosomal protein L36p" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (44 amino acids)

>GFF4374 LSU ribosomal protein L36p (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
VLNSLRNAKQRHPDCQIVKRKGRLYVICKTNPRFKAVQGRKKRR