Protein Info for GFF4373 in Xanthobacter sp. DMC5

Annotation: Transcriptional regulatory protein OmpR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 PF00072: Response_reg" amino acids 7 to 115 (109 residues), 103.7 bits, see alignment E=6.4e-34 PF00486: Trans_reg_C" amino acids 157 to 231 (75 residues), 75.2 bits, see alignment E=3.4e-25

Best Hits

Swiss-Prot: 52% identical to OMPR_SALTI: Transcriptional regulatory protein OmpR (ompR) from Salmonella typhi

KEGG orthology group: None (inferred from 86% identity to xau:Xaut_0373)

Predicted SEED Role

"Phosphate regulon transcriptional regulatory protein PhoB (SphR)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (238 amino acids)

>GFF4373 Transcriptional regulatory protein OmpR (Xanthobacter sp. DMC5)
LAPRTLLIVEDDREIRALLADFLGREGYGVLAAEDGAAMDRILASARPDMVILDLMLPGE
DGLSICRRLRARGGMPILMLTAKGDDVDRIVGLEMGADDYLPKPFNPRELLARIRAVLRR
ADGTLAEPTPRNRRVAFAGFVADLDARSVAEADGPLLDLTSAEFELLACFLERPKRVLSR
DQLLDWTRGRSADPFDRTIDVSVSRLRRKLSAVSEEAALLIKTVRNGGYLLTADVRQL