Protein Info for GFF4373 in Variovorax sp. SCN45

Annotation: FIG131328: Predicted ATP-dependent endonuclease of the OLD family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 712 PF13175: AAA_15" amino acids 1 to 386 (386 residues), 108.8 bits, see alignment E=1.7e-34 PF11398: DUF2813" amino acids 1 to 91 (91 residues), 25.5 bits, see alignment E=3e-09 PF13476: AAA_23" amino acids 5 to 54 (50 residues), 42.6 bits, see alignment 4e-14 PF13304: AAA_21" amino acids 25 to 70 (46 residues), 29.7 bits, see alignment 2.6e-10 amino acids 240 to 386 (147 residues), 39.9 bits, see alignment E=2e-13 PF20469: OLD-like_TOPRIM" amino acids 434 to 501 (68 residues), 57.8 bits, see alignment E=4.7e-19

Best Hits

KEGG orthology group: K07459, putative ATP-dependent endonuclease of the OLD family (inferred from 98% identity to aav:Aave_0676)

Predicted SEED Role

"FIG131328: Predicted ATP-dependent endonuclease of the OLD family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (712 amino acids)

>GFF4373 FIG131328: Predicted ATP-dependent endonuclease of the OLD family (Variovorax sp. SCN45)
MHISKLSLVNYRNFANTKLLFQKGINTIIGENGSGKTNLFRAIRLLLDDNMIRSAYRLES
TDFHRGLGRWQGHWIIISLEFEEISADEAVQALFRHGTGGIDDEAIGKATYNLIFRPKKE
IRLRLSQLDDGDHAGLAAILNAVTLDDYETIFTGRSDADFNDEAIYKEVVGDFEKARFNE
EIEFPAIGAKIPSVLSVSKEISFTFVQALRDVVSEFHNNRTNPLLSLLKGKSGDIDPVAF
QLITDGVKALNDSIEALPDVQVVRTDIRDTIKDAAGEAYSPSSLSIKSDLPDEADKLFQS
LKLFVGESGEGHEGPIHELSLGGANLIFLTLKLLEFKYQKAKQSIANFLLIEEPEAHIHT
HIQKTLFDRLQYDDTQIIYSTHSTHISEVSNVQNVNILGRERDRCEAYQPSSGLGPEEIG
NIQRYLDAVRSNLLFAKSVVLVEGDAEEILIPILVKKVLGISLDELGISLINIRSTGFQN
VAVLFHDDRIRKRCSIVTDLDKSIIDTTPVAGDPEGVLRRKKKYRASQESGIARKVLLDE
SFKDNPWVSPFFAPHTFEVDFVAAGNANKVVGILPDIYKDAPTIATAKAELESPDIALYG
QRVLTMAGNHGKGWFAILLGKKIDPQTAIPSYILDAIAFAHPVVTKEVWFNVLSYRVNYI
DAENLFIASAVFDGFRAKLLAFRKGDIDFVGIRNEMLATFPDDRINDVLKVF