Protein Info for GFF4372 in Variovorax sp. SCN45

Annotation: ATP-dependent DNA helicase UvrD/PcrA (EC 3.6.4.12)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 599 transmembrane" amino acids 185 to 209 (25 residues), see Phobius details PF00580: UvrD-helicase" amino acids 9 to 255 (247 residues), 157 bits, see alignment E=1.7e-49 PF13245: AAA_19" amino acids 17 to 249 (233 residues), 59.1 bits, see alignment E=1.1e-19 PF13361: UvrD_C" amino acids 509 to 569 (61 residues), 38.8 bits, see alignment E=1.6e-13

Best Hits

KEGG orthology group: None (inferred from 99% identity to aav:Aave_0675)

Predicted SEED Role

"ATP-dependent DNA helicase UvrD/PcrA" in subsystem DNA repair, bacterial UvrD and related helicases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (599 amino acids)

>GFF4372 ATP-dependent DNA helicase UvrD/PcrA (EC 3.6.4.12) (Variovorax sp. SCN45)
MFTWDKDDLNPEQEAAILEPGSVFLIACPGSGKTRTLTYKIAYELSRLKSNKQFVVAITY
THRAADEIHERIEGLGVDTSRLWIGTIHSFCLEWILKPYGIYHEALERGYRVIDQHEREK
ILETLCKPYQKPKITFWDCEFYFTETGYVLSCPQAWKHTGLHAILGQYFEKLQESRQIDF
ELILYYAYQLIVSRPAISVLLGQLFSFVLIDEYQDTKRIQYSIVTAILKAGQGATKAFIV
GDPNQAIYQSLGGYPIAFEDFRAMAGIDLKKLELSKNYRSSERIIDYFGNYNVHDTCIEA
ASDEKSYPSLVSFDATVNKTGLEAELIRLIRFNIETVGIAPHEVCVLAPQWTHLASMTRR
LCASMPEYSFDGPGMVPFARDTENFWYRLSKIALTQASPGMYVRRLRWAGEILTDLEAAG
VSVSKLTRKSLLRECNAIKIDETDGLTYLSTFFERLFSSLAIDFRLFTTLREHHTAFFDS
SQARVARLKSEGSEFIGDIGTFRKVFQSRTGITISTIHGVKGAEFDVVIAYALLEDMVPH
FNDPNGQESAMKLLYVIGSRARKNLHLISERGRIRQYSGDEYQVTRKLAACSFGYDQVP