Protein Info for GFF4371 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: ABC transporter related

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 PF00005: ABC_tran" amino acids 21 to 161 (141 residues), 116.5 bits, see alignment E=2.1e-37 PF17912: OB_MalK" amino acids 235 to 290 (56 residues), 47.9 bits, see alignment E=3.1e-16 PF08402: TOBE_2" amino acids 283 to 352 (70 residues), 40.2 bits, see alignment E=4.6e-14

Best Hits

Swiss-Prot: 52% identical to UGPC_SHIBS: sn-glycerol-3-phosphate import ATP-binding protein UgpC (ugpC) from Shigella boydii serotype 4 (strain Sb227)

KEGG orthology group: K02023, multiple sugar transport system ATP-binding protein (inferred from 52% identity to mci:Mesci_1922)

MetaCyc: 52% identical to sn-glycerol 3-phosphate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-34-RXN [EC: 7.6.2.10]; 7.6.2.10 [EC: 7.6.2.10]

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (365 amino acids)

>GFF4371 ABC transporter related (Hydrogenophaga sp. GW460-11-11-14-LB1)
MAQIVLNKLRKDFGPVSVVSEFSLTVAHGEFVVLVGPSGCGKSTTLRMVAGLEDTSGGSI
CIGERDVTHLEPKDRNIAMVFQNYALYPHKTVYENLAFGLRMRKTAPAEIAQQVKWAAEI
LGIEHLLERKPRQLSGGQMQRVSLGRALVRKPDAFLLDEPLSNLDAKLRVRMREEIGQLH
KRIHTSMIYVTHDQVEAMTLGDRIVVMHQGRVQQVGTPLQVYDHPANRFVAGFIGAPEMN
FIEGELVADAQGLRFDGPGVQVPIPRERWIGGSAPAVARRVVLGVRPEHLVPNDTGEIAA
TVGLVEQLGSQTLLVCDIGAGNSLRVLGGREDRFTRGAACRLTLHPQKVHLFDAEDGASL
LPPPP