Protein Info for GFF4371 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: methylated-DNA--protein-cysteine methyltransferase-related protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01035: DNA_binding_1
  • amino acids 33 to 112 (80 residues), 92 bits, E=8.6e-31
• TIGR00589: methylated-DNA--[protein]-cysteine S-methyltransferase
  • amino acids 33 to 101 (69 residues), 51 bits, E=5.7e-18

Best Hits

Swiss-Prot: 83% identical to ATL_ECOLI: DNA base-flipping protein (atl) from Escherichia coli (strain K12)

KEGG orthology group: K07443, methylated-DNA-protein-cysteine methyltransferase related protein (inferred from 99% identity to seg:SG0477)

Predicted SEED Role

"methylated-DNA--protein-cysteine methyltransferase-related protein"

Protein Sequence (129 amino acids)

>GFF4371 methylated-DNA--protein-cysteine methyltransferase-related protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MLVSCASGLSSPLIPDYPEALTQDSIMDIQDTFPQRVWQIVASIPEGFVTTYGDVARLAG
SPRAARQVGGVLKRLPEGSTLPWHRVVNRHGAISLTGPDLQRQRQALLAEGVVVSGSGQI
DLQRYRWVY