Protein Info for GFF437 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Electron transport protein HydN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 PF13247: Fer4_11" amino acids 53 to 142 (90 residues), 50.1 bits, see alignment E=1.1e-16 PF13237: Fer4_10" amino acids 55 to 100 (46 residues), 25.5 bits, see alignment E=4e-09 amino acids 82 to 135 (54 residues), 26 bits, see alignment E=2.8e-09 PF13187: Fer4_9" amino acids 58 to 104 (47 residues), 27.1 bits, see alignment E=1.4e-09 PF25160: LdpA_Fe-S-bd" amino acids 63 to 105 (43 residues), 29.5 bits, see alignment E=2.1e-10 PF12797: Fer4_2" amino acids 81 to 101 (21 residues), 26.1 bits, see alignment (E = 2.4e-09) PF12837: Fer4_6" amino acids 84 to 103 (20 residues), 25.8 bits, see alignment (E = 2.9e-09) PF00037: Fer4" amino acids 84 to 104 (21 residues), 30.2 bits, see alignment (E = 1.1e-10) PF12838: Fer4_7" amino acids 88 to 138 (51 residues), 27.7 bits, see alignment E=1.2e-09

Best Hits

Swiss-Prot: 72% identical to YSAA_ECOLI: Putative electron transport protein YsaA (ysaA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to see:SNSL254_A3944)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (157 amino acids)

>GFF437 Electron transport protein HydN (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MNRFIMADASACIGCRTCEVACVVSHQEQQNSAAVTTADFVPRIRVIKEDSFTTATVCHQ
CEDAPCANVCPVQAIRRDRGHIFVTSSRCIGCKSCMLACPFGAMTVVASASGAQAIKCDL
CWHREAGPACVEACPTSALQCVDAAHVQRQRLYSQPF