Protein Info for PS417_22350 in Pseudomonas simiae WCS417

Annotation: Fis family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 502 PF13188: PAS_8" amino acids 81 to 133 (53 residues), 20.7 bits, see alignment 1.1e-07 PF00158: Sigma54_activat" amino acids 194 to 360 (167 residues), 225.9 bits, see alignment E=8.8e-71 PF14532: Sigma54_activ_2" amino acids 194 to 365 (172 residues), 71.7 bits, see alignment E=2.6e-23 PF07728: AAA_5" amino acids 216 to 329 (114 residues), 25.4 bits, see alignment E=4.4e-09 TIGR04381: TyrR family helix-turn-helix domain" amino acids 452 to 499 (48 residues), 84.2 bits, see alignment 2.4e-28 PF18024: HTH_50" amino acids 452 to 498 (47 residues), 52.6 bits, see alignment 1e-17

Best Hits

KEGG orthology group: None (inferred from 98% identity to pfs:PFLU4895)

Predicted SEED Role

"Sigma-54 dependent transcriptional regulator/sensory box protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UEA7 at UniProt or InterPro

Protein Sequence (502 amino acids)

>PS417_22350 Fis family transcriptional regulator (Pseudomonas simiae WCS417)
MRIHVSFIDRVGITQEVLALLGGRNLNLDAVEMVPPNVYIDAPTLSADVLEELRDALFSV
QGVQAVKVVDILPGQRRHLQLDALLAAMTDPVLALDSAGKILLANPALIALYGREPAGES
ISELFNDPALLDTLLEQGFRLPLREISVNGQTLLLDATPITDAGALLTLYQPNRIGEQLS
ALHHDHAEGFDALLGESPVIRTLKARAQRVAALDAPLLIQGETGTGKELVARACHAISAR
HSAPFLALNCAALPENLAESELFGYAPGAFTGAQRGGKPGLMELANQGTVFLDEIGEMSP
YLQAKLLRFLNDGSFRRVGGDREVKVNVRILSATHRDLEKMVSEGTFREDLFYRLNVLNV
EVPPLRERGQDILLLARYFMQQACAQIQRPVCRLAPGTYPALLGNRWPGNVRQLQNVIFR
AAAICESSLVDIGDLDIAGTSVARQSDGEIDSLEQAVEDFERNLLETLYTSYPSTRQLAS
RLQTSHTAIAHRLRKYGIPNKP