Protein Info for GFF436 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Transcriptional regulator, IclR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 PF09339: HTH_IclR" amino acids 15 to 63 (49 residues), 52.9 bits, see alignment 2.5e-18 PF01614: IclR" amino acids 133 to 258 (126 residues), 144.9 bits, see alignment E=1.3e-46

Best Hits

Swiss-Prot: 91% identical to YIAJ_ECOLI: DNA-binding transcriptional repressor YiaJ (yiaJ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to seg:SG3764)

Predicted SEED Role

"Transcriptional regulator, IclR family" in subsystem Homogentisate pathway of aromatic compound degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (266 amino acids)

>GFF436 Transcriptional regulator, IclR family (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSQNNDKEKPAGSQSLFRGLMLIEILSNYPNGCPLAHLSELAGLNKSTVHRLLQGLQSCG
YVTPAPAAGSYRLTTKFIAVGQKALSSLNIIHVAAPHLEALNLTTGETVNFSSREDDHAI
LIYKLEPTTGMLRTRAYIGQHMPLYCSAMGKIYMAFGQPDYVASYWESHKDQIQPLTRNT
ITDLPAMYDELAQIRETSMAMDREENELGVSCIAVPVFDIHHRVPYAISISLSTSRLKQI
GEKNLLKPLRETAQAISNELGFTVRE